Extracted
Unclaimedspecialtyansweringservice.net
SpecialtyAnsweringService.net Answering service specializing in call center services.
Nationwide Answering Service And Call Center Support.
Extracted
UnclaimedSpecialtyAnsweringService.net Answering service specializing in call center services.
Nationwide Answering Service And Call Center Support.
4 of 5 safety checks passed (Sep 6, 2026).
What AboutUs observed on the live site and in WHOIS/DNS today. These are measurements, not an endorsement of the site.
Domain registered Oct 20, 2004 — 21 years old.
Registrar today: GoDaddy.com, LLC — unchanged since AboutUs began tracking (Aug 27, 2026).
Live site responds over HTTPS.
Trust record
Authority 55/100 — ahead of 55% of scored sitesClear
Every point maps to a sentence. These lines sum to the model score of 29/99, which is what places this site at 55/100 against every other scored site.
Dated record — historical facts always carry their date.
Domain registered (Oct 20, 2004).
Checked today — 4 of 5 safety checks passed (Sep 6, 2026).