Extracted
Unclaimedadvertisepayperclick.com
AdvertisePayPerClick.com
Pay Per Click Management - Overture and Adwords PPC guide
Suggest official facts
Correct a description, link or other detail. Submissions are reviewed before publication.
Extracted
UnclaimedAdvertisePayPerClick.com
Pay Per Click Management - Overture and Adwords PPC guide
Correct a description, link or other detail. Submissions are reviewed before publication.
0 of 2 safety checks passed (Sep 14, 2026).
Latest available measurements; dated entries retain their dates. These are measurements, not an endorsement of the site.
Domain registered Jun 30, 2010 — 16 years old.
Not delegated in the TLD zone as of Aug 18, 2026 — this domain no longer resolves.
Trust record
Authority: not enough signals yetSome caution flags
We withhold an authority number until independent evidence (global rank, link-graph presence) has accrued. The facts we do have about this site are shown below — we'd rather say “not enough signals yet” than invent a low score.
No unexpired threat-feed result; name-similarity check available (recorded about 28 days ago); 3/3 transport and email checks available (oldest recorded about 28 days ago). This is evidence coverage, not a probability that a website is safe.
Dated record — historical facts always carry their date.
Checked today — 0 of 2 safety checks passed (Sep 14, 2026).